PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast05G018400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 692aa    MW: 71693 Da    PI: 6.0671
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast05G018400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.2e-093804171954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  Brast05G018400.1.p 380 FEHflHPYPKDSDKIMLAKQTGLSRSQVSNWFINARVR 417
                         554459******************************88 PP

2BELL1123.2e-36239310172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         erqelq+kk kL+++l+eV++rY+qy+ q+++v ssFea ag g+a+ Yt+lAl++iSr+FrcL+daia+qi
  Brast05G018400.1.p 239 ERQELQMKKGKLVNMLDEVEQRYRQYHGQMRAVSSSFEALAGAGAARTYTALALRTISRQFRCLRDAIAGQI 310
                         79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-55169308IPR006563POX domain
PfamPF075261.4E-47174307IPR006563POX domain
PROSITE profilePS5007112.228358421IPR001356Homeobox domain
SMARTSM003891.3E-9361425IPR001356Homeobox domain
CDDcd000867.07E-13361422No hitNo description
SuperFamilySSF466897.7E-17362427IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-28364427IPR009057Homeodomain-like
PfamPF059201.6E-18378417IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MAAYYHGGGT DIQAGGGGSD GGGGLQTLYL MNPSYGPGAA AGYNDAGAGA SMMLLNSAAA  60
MTPASSFGHH QASQQQHFVG IPLQQPPPPG SSYHSLWTTP ADMSSSSPPL TTTAAQGQGM  120
QQQQHVSAVL SLSSSRTREA PVTVAAVAGD EDDGRYSHLI APGAMAPSQG QGQVVMSSKY  180
LRAAQELLDE VVSVSKQGGV DDDVDGKQEA AAKSVKKKEE DEAREDAAGK SAPEMSTAER  240
QELQMKKGKL VNMLDEVEQR YRQYHGQMRA VSSSFEALAG AGAARTYTAL ALRTISRQFR  300
CLRDAIAGQI RAASRALGED LSDAGGGGRG GVGSRLRYID HQLRQQRALQ QLGMMQGSSA  360
WRPQRGLPER SVSVLRAWLF EHFLHPYPKD SDKIMLAKQT GLSRSQVSNW FINARVRLWK  420
PMVEEMYLEE TKEQQKQQGG VNGGDEAMAA AVGGIRSGGA AGKGSGGGGG GGESSTTPRA  480
QMGGSGGFYD EIGDEEEEDG GEGEEEDDGF RRGLFKKARA AAAGDEPPPA VQTFDVAALH  540
HHAQAAAAAA ARQQHEEQVS HRELLMKFME SGGGNGAAAA AARDHHDGGG GYSLFSPPGH  600
PYAVGQFAGS DNPFAFAHGG GNSGGGVSLT LGLPHGAGEQ TAASFLMGGG GNGGGSTGGA  660
DSGGGGYEMN LQMQSTKSSS FAAQLMRDFV A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A8e-17367425159Homeobox protein Meis2
5bng_B8e-17367425159Homeobox protein Meis2
4xrm_B9e-17367425563Homeobox protein Meis2
4xrm_A9e-17367425563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3546391e-169AK354639.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1009H02.
GenBankAK3550781e-169AK355078.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1015J22.
GenBankAK3665361e-169AK366536.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2043O18.
GenBankAK3743451e-169AK374345.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3061L07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576293.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010237922.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_010237923.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-105BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0Q3EST80.0A0A0Q3EST8_BRADI; Uncharacterized protein
STRINGMLOC_68213.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-64BEL1-like homeodomain 1